General Information

  • ID:  hor003026
  • Uniprot ID:  Q0VBW8(104-136)
  • Protein name:  Neuromedin-S
  • Gene name:  NMS
  • Organism:  Bos taurus (Bovine)
  • Family:  NmU family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Bos (genus), Bovinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  FWRRDSRATAADFTKKDYTATLGRPFFLFRPRN
  • Length:  33(104-136)
  • Propeptide:  MKYLAQFPSILAIYCFCLLQIPSSGFPRPLADASDGLDIVKFEQMAYWASLSRQPKDNQDIYKRFLFHYSRTQEPAHPVKTGFPPVHPLMRLAAKLADRRMKTFWRRDSRATAADFTKKDYTATLGRPFFLFRPRNGRNLDFDTW
  • Signal peptide:  MKYLAQFPSILAIYCFCLLQIPSSG
  • Modification:  T33 Asparagine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Implicated in the regulation of circadian rhythms through autocrine and/or paracrine actions.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NMUR1
  • Target Unid:  F1MY53
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q8LAD7-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-Q8LAD7-F1.pdbhor003026_AF2.pdbhor003026_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 458048 Formula: C184H275N55O47
Absent amino acids: CEHIMQV Common amino acids: R
pI: 11.88 Basic residues: 8
Polar residues: 8 Hydrophobic residues: 12
Hydrophobicity: -89.09 Boman Index: -11199
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 35.76
Instability Index: 5026.06 Extinction Coefficient cystines: 6990
Absorbance 280nm: 218.44

Literature

  • PubMed ID:  NA
  • Title:  NA